"message" : "2091208", // Oops, not the right sequence, lets restart from the top. { "context" : "", "action" : "rerender" "useCountToKudo" : "false", }, } }, } { { } ] "action" : "rerender" { ] "event" : "removeMessageUserEmailSubscription", { "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "MessagesWidgetEditAnswerForm", } } }, "useSimpleView" : "false", } ] }, "action" : "rerender" "componentId" : "forums.widget.message-view", { { "revokeMode" : "true", "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", if ( key == neededkeys[0] ) { { "event" : "removeThreadUserEmailSubscription", ] "includeRepliesModerationState" : "false", return; { "parameters" : { "action" : "rerender" ] ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", "displaySubject" : "true", "event" : "ProductMessageEdit", "event" : "addThreadUserEmailSubscription", "context" : "envParam:quiltName", } { }, "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "parameters" : { } { "action" : "rerender" "actions" : [ }, "event" : "MessagesWidgetEditAnswerForm", window.location.replace('/t5/user/userloginpage'); LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.Auth.CHECK_SESSION_TOKEN = '4L15ZpDgf3DRdlEKshhtHNrt4g-Bpgvy07v-Pz8pHRs. ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "useTruncatedSubject" : "true", LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'DR1LtyJkaXf91NFUC-slCefEhSWn8LdVvBIsu3D_Fg8. { "actions" : [ { "componentId" : "kudos.widget.button", ;(function($) { })(LITHIUM.jQuery); "includeRepliesModerationState" : "false", ;(function($) { { "eventActions" : [ "actions" : [ "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "removeThreadUserEmailSubscription", "initiatorDataMatcher" : "data-lia-kudos-id" }, "action" : "rerender" }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'lYfAJjbIWx3Xl9oTst_EXqIh5XAXJlEqXvn8zPT0U_E. "quiltName" : "ForumMessage", "showCountOnly" : "false", "action" : "rerender" // enable redirect to login page when "logmein" is typed into the void =) "action" : "rerender" } } ] { o.innerHTML = ""; { ] { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; return false; var expireDate = new Date(); }, "componentId" : "forums.widget.message-view", { ] { ] ] }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2086942 .lia-rating-control-passive', '#form_0'); ] "selector" : "#kudosButtonV2", }, "selector" : "#messageview_1", { }, { "displaySubject" : "true", "event" : "ProductAnswer", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); { "initiatorBinding" : true, "truncateBodyRetainsHtml" : "false", "context" : "envParam:quiltName,message", "parameters" : { LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "event" : "MessagesWidgetAnswerForm", Wir sind dran. "context" : "envParam:quiltName,message", ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "kudosable" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ } "event" : "MessagesWidgetCommentForm", { { "context" : "lia-deleted-state", "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); } { } "event" : "addMessageUserEmailSubscription", ] "revokeMode" : "true", "revokeMode" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); "context" : "", { "displaySubject" : "true", }); }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); })(LITHIUM.jQuery); "dialogKey" : "dialogKey" "context" : "envParam:quiltName,product,contextId,contextUrl", { } "actions" : [ $(document).ready(function(){ }); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2099958 .lia-rating-control-passive', '#form_7'); { }, "eventActions" : [ { }, "parameters" : { ] ;(function($) { } }); LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "action" : "rerender" LITHIUM.AjaxSupport.useTickets = false; }, "action" : "pulsate" "actions" : [ "event" : "unapproveMessage", { "event" : "kudoEntity", "useSubjectIcons" : "true", ] "actions" : [ if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") }, "event" : "MessagesWidgetAnswerForm", "action" : "rerender" { { }, "quiltName" : "ForumMessage", "}); } ] { "action" : "pulsate" { ] // just for convenience, you need a login anyways... "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "action" : "rerender" { } }, "displayStyle" : "horizontal", { }, "action" : "rerender" o.innerHTML = "Page number can\'t exceed 3. "event" : "removeMessageUserEmailSubscription", } "context" : "envParam:quiltName", { { { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] "context" : "", "entity" : "2091208", LITHIUM.AjaxSupport.ComponentEvents.set({ { }); ] "context" : "envParam:quiltName,message", { "message" : "2086329", "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "approveMessage", { }, }, { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "includeRepliesModerationState" : "false", "event" : "deleteMessage", }, "event" : "MessagesWidgetAnswerForm", var key = e.keyCode; ;(function($) { ', 'ajax'); "actions" : [ "selector" : "#kudosButtonV2_5", { { // --> { if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") "kudosable" : "true", LITHIUM.Loader.runJsAttached(); } { "triggerEvent" : "click", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); } }, "event" : "MessagesWidgetAnswerForm", "useCountToKudo" : "false", { { "event" : "approveMessage", "disableKudosForAnonUser" : "false", { { ] "actions" : [ }, "disableKudosForAnonUser" : "false", "revokeMode" : "true", "action" : "rerender" { "}); { { { "disableLabelLinks" : "false", } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { { } "buttonDialogCloseAlt" : "Schließen", "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2194972 .lia-rating-control-passive', '#form_1'); "context" : "", { } { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_307fe4216d4619_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/CallYa/thread-id/85852&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "message" : "2197583", "useCountToKudo" : "false", ] "context" : "envParam:entity", ] "defaultAriaLabel" : "", { }); }, "entity" : "2089629", "showCountOnly" : "false", } "actions" : [ ] "context" : "", "event" : "approveMessage", "context" : "envParam:quiltName,product,contextId,contextUrl", { "action" : "rerender" LITHIUM.Loader.runJsAttached(); "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "deleteMessage", { }, }, $(document).keydown(function(e) { "event" : "removeThreadUserEmailSubscription", ] { .attr('aria-hidden','true') //$('#lia-body').removeClass('lia-window-scroll'); "actions" : [ "action" : "rerender" }, { { { ] "actions" : [ { "; } }, "truncateBody" : "true", ] ;(function($) { "action" : "pulsate" "context" : "", "event" : "MessagesWidgetEditCommentForm", { "event" : "unapproveMessage", Rufnummer per PM (links auf meinen Namen klicken und dann rechts auf  "Diesem Benutzer eine private Nachricht senden"). "; } }, { "actions" : [ watching = false; if ( !watching ) { "event" : "MessagesWidgetMessageEdit", "actions" : [ "action" : "rerender" document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); { "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/89534","ajaxErrorEventName":"LITHIUM:ajaxError","token":"wWXzb5bQYrf2UitvSA8vbqZ2L6oBYAiCIOx9ZAHZAW4. }, "forceSearchRequestParameterForBlurbBuilder" : "false", { ] "context" : "", "event" : "kudoEntity", "actions" : [ "actions" : [ o.innerHTML = ""; $(document).ready(function(){ { "context" : "envParam:quiltName", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "selector" : "#kudosButtonV2_8", "truncateBody" : "true", document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "action" : "rerender" { "useSubjectIcons" : "true", "action" : "rerender" "action" : "rerender" "selector" : "#kudosButtonV2_2", { "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "disallowZeroCount" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "", if (isNaN(val) ) "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } if (isNaN(val) ) }, "message" : "2471194", "event" : "expandMessage", { "event" : "unapproveMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'zddbMw4PkO6vb7mnWFFZkMZ0iCK_B8wgFwxMCA2__Ds. ] "}); "actions" : [ { "actions" : [ } }, "context" : "", }, "initiatorBinding" : true, $('.css-menu').removeClass('cssmenu-open') LITHIUM.Dialog.options['1387556763'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "eventActions" : [ "useCountToKudo" : "false", ] "action" : "rerender" { { { ] "action" : "addClassName" "componentId" : "forums.widget.message-view", "selector" : "#messageview_4", "context" : "", "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" { "event" : "kudoEntity", "context" : "envParam:selectedMessage", "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } ] { } { "action" : "rerender" ;(function($) { ] } "eventActions" : [ }, { "disableKudosForAnonUser" : "false", "context" : "envParam:selectedMessage", { "disableLabelLinks" : "false", "actions" : [ }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/CallYa/thread-id/85852","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7fvce-XY0e_5v_HZNM8WOqeyOocNyo_xTV2D3Blulnk. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", } LITHIUM.Loader.runJsAttached(); "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "context" : "", "action" : "rerender" { "actions" : [ "linkDisabled" : "false" } ] "event" : "QuickReply", "event" : "deleteMessage", "; })(LITHIUM.jQuery); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); "context" : "", "quiltName" : "ForumMessage", "useSimpleView" : "false", "parameters" : { ] ;(function($) { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/CallYa/thread-id/85852","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ARrwgDndUB8RRsXCk5SqWoqZGtNtqJw2CuRA2wEhxyQ. ;(function($) { }, "context" : "envParam:entity", ', 'ajax'); ] { ] "quiltName" : "ForumMessage", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "event" : "MessagesWidgetMessageEdit", }, "context" : "envParam:quiltName,message", ] window.location.replace('/t5/user/userloginpage'); "componentId" : "kudos.widget.button", { LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { }, "disableLabelLinks" : "false", "action" : "rerender" "event" : "ProductAnswerComment", "event" : "MessagesWidgetAnswerForm", "action" : "pulsate" { "useCountToKudo" : "false", "actions" : [ ] // Oops. "disallowZeroCount" : "false", "action" : "rerender" "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "forceSearchRequestParameterForBlurbBuilder" : "false", "disableKudosForAnonUser" : "false", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); { "forceSearchRequestParameterForBlurbBuilder" : "false", "showCountOnly" : "false", { } { }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; }, "actions" : [ "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", { { "context" : "", "action" : "rerender" ] { }, { ] }, "event" : "editProductMessage", "action" : "rerender" } "messageViewOptions" : "1111110111111111111110111110100101001101" }, "disableKudosForAnonUser" : "false", ] ] }, } { }, "context" : "", "event" : "deleteMessage", "event" : "AcceptSolutionAction", } "event" : "unapproveMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'sQDkxszoNbcJ-V8tLDmuMwEWCMJVGInZScrYpoXy6YA. } "actions" : [ "action" : "rerender" { setWarning(pagerId); o.innerHTML = "Page number can\'t exceed 3. { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/85852","ajaxErrorEventName":"LITHIUM:ajaxError","token":"sMgsnsUU-y5ad6_AKehV47pp2lIjVDqgAk6eRDmkeZw. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/85852","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BxCcC5Yd7Ex7_uZCY2SaXGtXcDFDX-hmzRHVqpqdt_0. { ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "removeMessageUserEmailSubscription", { { "context" : "", }, "context" : "", { // console.log('watching: ' + key); ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" } "disallowZeroCount" : "false", ] "context" : "", "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2099816 .lia-rating-control-passive', '#form_5'); "componentId" : "kudos.widget.button", })(LITHIUM.jQuery); // Pull in global jQuery reference "context" : "", }, { "action" : "pulsate" "context" : "", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] "initiatorBinding" : true, } { }, window.location = "https://forum.vodafone.de/t5/CallYa/Callya-Digital-automatischer-Bankeinzug/td-p/2086329" + "/page/" + val; $('#custom-overall-notif-count').html(notifCount); "displayStyle" : "horizontal", //$('#lia-body').addClass('lia-window-scroll'); "actions" : [ "context" : "", { { }, { LITHIUM.AjaxSupport.ComponentEvents.set({ if ( neededkeys[count] == key ) { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2099928 .lia-rating-control-passive', '#form_6'); "action" : "rerender" "actions" : [ "actions" : [ }, "}); "forceSearchRequestParameterForBlurbBuilder" : "false", }, "context" : "envParam:feedbackData", ;(function($) { "action" : "rerender" } "actions" : [ "event" : "addThreadUserEmailSubscription", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "disableKudosForAnonUser" : "false", "context" : "envParam:quiltName,product,contextId,contextUrl", { } ] ] "actions" : [ "action" : "rerender" }, "parameters" : { } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "linkDisabled" : "false" { }, "defaultAriaLabel" : "", { ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ { "action" : "rerender" { ] } "actions" : [ ], "action" : "rerender" "action" : "rerender" { ] ] "componentId" : "forums.widget.message-view", "event" : "AcceptSolutionAction", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { resetMenu(); "revokeMode" : "true", "event" : "ProductMessageEdit", "action" : "pulsate" "entity" : "2099816", "context" : "", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "markAsSpamWithoutRedirect", "componentId" : "forums.widget.message-view", "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" "action" : "rerender" { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", ] { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); { "selector" : "#kudosButtonV2_2", "}); "event" : "removeThreadUserEmailSubscription", { { "message" : "2197583", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.ComponentEvents.set({ var o = document.getElementById("custom_board_pagination_warning" + pagerId); { }, "buttonDialogCloseAlt" : "Schließen", "action" : "rerender" resetMenu(); }, $(document).ready(function(){